DPCstruct | MC52058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A525VQD5 | 11-72 | MRLLTVVAAPRERIEKLITRHETLEHYYRNDWVHLVALEPEEGVLYRYRPTDEWVTAMKLTA |
| A0A7Z9L8D6 | 421-487 | DGSVHYHEPMRLLAIIEAPTDRISSAIEKHSLLQQLFHNQWIILVAVDPSTREFQQYNPDATWEACQ |
| A0A1H0W8D2 | 12-87 | None |
| A0A5C8YAF9 | 51-116 | None |
| U1Q6R9 | 161-232 | None |
| A0A1V3XC93 | 1-64 | None |
| A0A2D6PM46 | 41-105 | None |
| A0A090D0J7 | 670-738 | None |
| F8UH58 | 2-65 | None |
| A0A533XI82 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.