DPCstruct | MC52057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1K7I1 | 51-143 | EKCAHCKQPVIDAIKKGEKQADPAERAFCGHWFHSSCLEHVMTKPPFGMQCPGDGCDSRVFHPKWTSDVKTLERRWAAAQARQREVD… |
| A0A6A4WWM4 | 1-105 | MMRCAGEGTVRIRVPEVALPADPADVVEDGGADLHVERVYCGHLYHFGCLVQYMKTPPFDGGKKCELCGKRIFHEKYKVSPQLAEAR… |
| A0A7R8CV43 | 225-312 | None |
| A0A7J6ZH63 | 248-325 | None |
| A0A830HD88 | 382-500 | None |
| A0A7R9EDX7 | 166-284 | None |
| A0A7R9D4F0 | 79-160 | None |
| A0A6A4JQG4 | 1122-1210 | None |
| A0A7J6ZBT7 | 619-706 | None |
| A0A7S2ATU4 | 70-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.