DPCstruct | MC52055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 90 ± 17 aa |
| Standard deviation of domain lengths | 16.85 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 67.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.97 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 41.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834MDC7 | 34-128 | GMPGDQGPPGEQGEPGPVGPPGPPGMDGMTGPKGDRGDKGERGLTTTIAGDVKFPTGIIEGPPGPPGQPGEKGEAGPVGPKGAPGEK… |
| Q4RUE1 | 30-148 | SMGHKGNTGPPGLRGPKGAEGSRGNQGARGVQGGLGKQGENGARGSVGIRGQFGPGGNTGGAGAKGQKGLQGHMGSVGKLGPNGALG… |
| A0A498NVV4 | 34-131 | None |
| A0A2I4D8L1 | 1-78 | None |
| A0A822DLK1 | 6-84 | None |
| E9G0X4 | 127-218 | None |
| A0A377D6F1 | 28-129 | None |
| A0A848LBS3 | 18-92 | None |
| A0A3Q3F244 | 25-139 | None |
| A0A4U5M0M8 | 54-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.