DPCstruct | MC52054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 239 ± 29 aa |
| Standard deviation of domain lengths | 29.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DNV0 | 85-311 | PGVSDQCRRITVSGQLIGDVPIQYTVIGLNAYEIPVIGTYVDPRIVPGFDYRVRPAGGKHHLFQGRALTLTSVGPGYGKRLTFAPDL… |
| A0A834MC41 | 35-227 | EVNETEDILTVSSRQNSWSNACLPPPQKATCSEFENDPELLDVPGSTSCLRTTPKFQQSFLKLDASTIGDLPAHYVICALQPHQLPV… |
| A0A482X4F2 | 24-299 | None |
| A0A2B4S925 | 336-551 | None |
| A0A6P8HF98 | 59-335 | None |
| A0A653BMR1 | 27-254 | None |
| B7PDL2 | 2-232 | None |
| A0A7I8VM81 | 48-271 | None |
| R7TR93 | 4-270 | None |
| A0A834M6N3 | 3-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.