DPCstruct | MC5205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I5VN30 | 11-151 | VEPVVGWPRITATIDSETDGTLVINNVLHPCWAASAEILRTGMIARCAAVAITLGRPVRLDVTDSGRPLALAVRPDGVVQEIDGQGR… |
| A0A1M3M0C2 | 1-143 | MPTFIPAQPRLSAIVRADASGELTISGTSRALIATDTARIRAGIIARCAAIGRQVGRPVRLTVADVDGTYQLGIHPDAFVQILNPDG… |
| A0A1Q3PR33 | 3-102 | None |
| A0A511D6X7 | 24-122 | None |
| A0A7Y2W2Z6 | 4-108 | None |
| A0A1D9FGD6 | 28-153 | None |
| A0A7X6KY46 | 1-139 | None |
| A0A0U3NTH6 | 4-116 | None |
| A0A7X0K938 | 1-133 | None |
| I1Y9I9 | 7-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.