DPCstruct | MC52046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 18.30 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 97.87 |
| Assigned Pfam label(s) | CL0268- PF20241- PF00162- CL0208- PF04398 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6Q3D6 | 11-124 | IPTAYEMLEKYNLTRGILPEGVTGYVLHPDGSFEAYLPGDCNIHAANMQIKYSSRIAGNIQAQWIRSLEGVKVEMMLVWIGVTQVTR… |
| A0A446TP94 | 2-72 | EEFGYNCAAGFMWLVQRKKTEHTFKKVKQTVSYAGEVTAFVEPGKLRKIAGVKTKELFLWLSVVEVYVLSK |
| A0A811ML15 | 90-217 | None |
| A0A1R3K879 | 264-394 | None |
| A0A0E0HW37 | 23-150 | None |
| A0A6P8BY87 | 14-116 | None |
| A0A6A6LD09 | 136-249 | None |
| A0A0H5E679 | 334-463 | None |
| A0A4U6TKB5 | 16-113 | None |
| A0A396HAY9 | 9-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.