DPCstruct | MC52045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 155 ± 13 aa |
| Standard deviation of domain lengths | 13.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811NP80 | 1-145 | MPFDSLIRHLLAGKILKHRIIRANKCPLFLLLAPFISDEHGIEGRLYFMQKDCNVLDDEFCLAVSLQLSESTDIVGVAIQCLQLFAP… |
| A0A0P0W6L4 | 159-314 | FFDPLIAHLFAGKSLRYQTLHDGSQYHFFSIRPMSFEERGLEAMLFFVYEDCKVPKNSFRLGFILRLSESTDVMGITVKCLQSVTPH… |
| A0A3L6TCZ5 | 159-318 | None |
| A0A0D3GLR3 | 203-374 | None |
| A0A0E0LGH5 | 775-946 | None |
| A0A811Q743 | 162-297 | None |
| A0A0E0D9Y1 | 32-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.