DPCstruct | MC5204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0CBW8 | 77-191 | TPARVIMQDFTGVPCVVDLATMREAVKELGGDPAKINPLAPAELVIDHSVIADKFGTSEAFAQNVELEYGRNKERYQFLRWGQTAFD… |
| A0A7J8FVN5 | 78-173 | ANQDIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVG… |
| A0A5N5IYN3 | 1-87 | None |
| A0A2P5F2I4 | 19-116 | None |
| A0A2U3RQY8 | 1-92 | None |
| L1KTH2 | 77-179 | None |
| M4CFG2 | 1-78 | None |
| A0A534BGN1 | 84-185 | None |
| A0A7R9KP80 | 301-382 | None |
| A0A388NNK8 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.