DPCstruct | MC52031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 156 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2IQT1 | 35-189 | IDPIAYYQMPYARKPGIARSLGKLNWHFREAGKNLVLFAPGRIGTSSPELGVPTAFSDISSFGAICEIAESRAGYQPELSYGSHIFQ… |
| A0A7C4BMZ4 | 20-175 | SYQDLVNIGKIVSRLNQILPRRQFILMGPGRWGSRGDIKLGVSVTYSDINNTAMLIEIARKKKDYVPDLSFGTHFFQDLVEASIRYL… |
| A0A1V4WGQ7 | 228-403 | None |
| A0A1V6G0I4 | 5-148 | None |
| A0A662BSQ7 | 536-720 | None |
| A0A3M1VQM6 | 631-816 | None |
| A0A173Z7V1 | 144-300 | None |
| A0A497AG62 | 5-131 | None |
| A0A8B5WWQ2 | 740-919 | None |
| A0A239R4M3 | 116-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.