DPCstruct | MC52028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0XK64 | 445-602 | LGMVSAIFLAGSIVMLFFVILGGVKDRTPLNHTYFLQADTSGIAGAKDLSQWTYFHICGTHNQNCGKAHPAMPFGAAWASHATDAPS… |
| A0A094ICT4 | 19-166 | AGALVMMWLVVLAGVTRHTPLNKIYFLRADTSGIGDARPISQWTFWYVCGSNNDNCGSPVPALPIGYAWRGNSAGAPSALVGSHGHD… |
| A0A4P6XU24 | 3-154 | None |
| A0A1E3PL66 | 13-173 | None |
| A0A420HKA6 | 2-151 | None |
| A0A0A8LDF1 | 2-163 | None |
| A0A5N6K861 | 76-236 | None |
| A0A1G4KQK4 | 5-170 | None |
| A0A109UYE9 | 4-164 | None |
| A0A4V5NDD4 | 4-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.