DPCstruct | MC52023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 160 ± 39 aa |
| Standard deviation of domain lengths | 38.62 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7IT89 | 41-178 | FRRGTREEEEAGKFLGSETCSIYDEIDENLFALAYGQLRTLFGEPDYETEDLENMYDYNVVATDKDGNEYYMYAYSGPTGPAIGTRE… |
| A0A5C6FJU9 | 37-187 | TSFSAQFNLIDWAREQQRKLPAIVRGDENAAWFLGRLIYLFNTENVAEDERMEKTCFDVSFVAILSDASNLAVPFDCSDHYGRTSLM… |
| A0A1B8WII5 | 17-149 | None |
| A0A2W4J0E9 | 37-171 | None |
| A0A2T2S836 | 19-177 | None |
| A0A4Q4KJC9 | 6-127 | None |
| A0A533QR18 | 2-182 | None |
| A0A2N2PR87 | 1-199 | None |
| A0A7X8HPX5 | 26-243 | None |
| A0A1Y4IJ37 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.