DPCstruct | MC52022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6EUS5 | 7-88 | IPNKFKPWIAIRKKFGLSHTHVQMARELGMDIKRIRQPAKPDPNMPGRLPLNKYIEKLYLERFDKAEPDEVKSMEDLAAEHM |
| M5S467 | 7-88 | ARIPHKFLPWIAIRKQYSLTHAEVQMARELGLEPRRFPSYANIKDQPWKKPLKEFIAELYLKQTGKEQPETIYSMEELAAQH |
| A0A2H6FVC8 | 2-73 | None |
| Q3ARB6 | 1-83 | None |
| A0A2W5ZR29 | 4-89 | None |
| A0A6I0LSZ5 | 1-98 | None |
| A0A538Q8S6 | 1-93 | None |
| D0LS18 | 8-90 | None |
| F8X428 | 2-94 | None |
| A0A1J5E1G6 | 4-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.