DPCstruct | MC5202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 605 ± 56 aa |
| Standard deviation of domain lengths | 55.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 71.67 |
| Assigned Pfam label(s) | CL0177- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M3YL45 | 2-490 | RVTPVATTPAMTALTADPRWDPTLGPPPALWVPFSSDATARAAQALDGQTRSLATSPVVLAVPAELERALSTAGTGWRQLPSLQSDG… |
| A0A6G4U4I1 | 305-852 | PCPPPLELRMATAPEEVAPMSELVEEFEKSGADHADNGRARDCRTARITVYGTGLDALGSAFAHAGDWGGGARGALADVGPQPDLWA… |
| A0A5M3VUB5 | 1-645 | None |
| A0A7C3C2H0 | 218-884 | None |
| A0A7I7XWM3 | 188-761 | None |
| A0A1G7QUP2 | 76-657 | None |
| A0A542T8J9 | 244-872 | None |
| A0A1C5I0R4 | 229-836 | None |
| A0A1H9ESR7 | 393-1006 | None |
| A0A1Q8CJV8 | 63-790 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.