DPCstruct | MC5201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1B256 | 3-100 | FVTGFATTFVHYPLVPVHLDSAHWSSAWLIATIGDYYATSLCYCGIILATEGLWPGVVWCACVLVLGSGVSCLWVVYRILAHKSLAL… |
| A0A3S5IXD3 | 5-95 | ILFYTVLGLVCCLALMFTLSAHPLLDWKVHNLDWVRAWLRMTVLDYYGAAFALSGVAFSERSKQEALAWSFGFFILGSPVCCAYIVY… |
| A0A1E7FFK9 | 51-148 | None |
| A0A7S2BJE2 | 87-185 | None |
| A0A7S0CDF2 | 7-113 | None |
| A0A7S3F2R0 | 2-97 | None |
| A0A7R9WEZ0 | 9-110 | None |
| A0A6U3TPH6 | 5-103 | None |
| A0A7S1RVQ8 | 98-205 | None |
| A0A5E8CFW5 | 18-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.