DPCstruct | MC52006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 64 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2XEG9 | 14-73 | ALSIPLAAYAATYIGNRNSWKFHYQGCRWERKMNESNRIYFSSRQEAIDMGMAPCKVCRP |
| A0A1Q3P9C3 | 16-74 | RKLKEMIDNRQITVAGNRNLKIYGRLSCGSGKRMKRSNRVFFTDERDALAHGYRPCGHC |
| A0A3M1NFP3 | 215-285 | None |
| Q1NTJ8 | 100-161 | None |
| A0A7J4PSU2 | 196-254 | None |
| A0A2Z1C9V2 | 236-307 | None |
| A0A7L9WSR2 | 9-61 | None |
| A0A419F6W2 | 31-104 | None |
| A0A2H0YAS7 | 107-158 | None |
| A0A847AW08 | 71-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.