DPCstruct | MC52003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 310 ± 79 aa |
| Standard deviation of domain lengths | 78.71 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4NLK4 | 18-297 | RIYLSYREGFAPLSPTNLTTDCGWGCMIRTTQMMIAHAFQVQFCGREWRYKDEEEHRGTIHSDILKWFCDSYSPQCHYSIHRACHLG… |
| A0A162JUY5 | 170-328 | FTSDSGWGCMIRSGQSLLANAMAFLILGRDWRRGMFPDRERRLLALFSDDPRAPYSIHNFVRYGEKFCSKYPGEWFGPSATARCIQE… |
| A0A3S3PUD2 | 98-316 | None |
| A0A212CFP9 | 1-286 | None |
| A0A146I4Z0 | 33-408 | None |
| A0A6P5FH66 | 31-296 | None |
| F4Q5K2 | 157-615 | None |
| A0A1I8IC84 | 219-480 | None |
| A0A433Q7Z5 | 14-362 | None |
| A0A0V0QZW2 | 115-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.