DPCstruct | MC52001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 378 |
|---|---|
| Mean domain length (aa) | 327 ± 73 aa |
| Standard deviation of domain lengths | 73.45 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 88.67 |
| Assigned Pfam label(s) | PF00566- CL0123- CL0072- CL0542- PF00617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4L6A4 | 45-384 | EDAANKASAGEALRYILTSWFKQSGAVYEKQHPKFFRTVASFVGSSKDPRINPLKLMILRNNFDSHEDTSKPFYRSIIEQTKQMKEL… |
| A0A0S7LP46 | 38-223 | GPSAGSMSTFELMSSKDLAYQMTMFDWELFSCVHEHELLYHTFGRHSFRRTTANLDLFLRRFNQVQLWVVTEVCLCTQLSKRVQLLK… |
| A0A6P6QAT2 | 22-296 | None |
| A0A553NRV5 | 176-455 | None |
| A0A3Q0J3P9 | 164-486 | None |
| A0A668RHB6 | 116-418 | None |
| A0A0K0EC56 | 832-1141 | None |
| A0A814UF05 | 180-401 | None |
| A0A6P6PA86 | 54-437 | None |
| A0A3Q0JGT4 | 289-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.