DPCstruct | MC5200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7WQ64 | 1-94 | MMDVLYKCEDVRDHVNELCELATRASGFMGTGWQAMEKVENVDEVSKHCMEAYDSLLTAHPAFKPKIEQTVGHGLAILRSKHKFRWS… |
| U6N565 | 404-516 | AKPFQEDPQVQQQLLSLQRLFDLLHVVEDFRDHLNEIMELQSRSSGLGGTGVLASPPVSNIEEHAAAAAAAYLLLLQQHKEFAAKTE… |
| A0A2C6KUF8 | 153-265 | None |
| Q7RPX7 | 36-149 | None |
| K6ULC8 | 141-252 | None |
| A0A812N984 | 190-306 | None |
| U6M735 | 93-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.