DPCstruct | MC520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 121 ± 19 aa |
| Standard deviation of domain lengths | 18.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453KZ30 | 47-162 | MSVNDMATADVAAGDIIVLPLPACTSSFPTFTSDHGLAVANGTYAVTADRCVQCSCGPANLELFCVPAPLADAACSSMQCGNSSMML… |
| A0A835CKE3 | 8-125 | VRDDSLDYPLLVPTNSYVYTANGCVRCKCDAAYYNWTLQCEPSHLKPTNWSTCPSMQCNISSNMYIIGSTTHSGSHNVTFCAYSGYG… |
| A0A2G3D025 | 195-315 | None |
| A0A287RLY1 | 226-329 | None |
| A0A5P1F5L4 | 114-242 | None |
| M0ZJZ7 | 110-260 | None |
| A0A6P5GQA9 | 153-296 | None |
| A0A4Y1RJ48 | 4-121 | None |
| A0A3S3QHP6 | 211-323 | None |
| A0A7I8J4L8 | 190-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.