DPCstruct | MC52
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 154 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0023- PF17764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1PJQ7 | 27-176 | SAVKNDRTFWRITDAGKNALEQGELKRSKKQAEALQCLSETDLEKGNNNFSSAIWSALKAKGFIEEITIQTNPLSWQQRLGNNPIVN… |
| T0U6P0 | 1-146 | MVKRLISPEAIPEAMKQIRKGAKRQQQLLTVLQESDQLPVSFFAEAGISTAVLNQGQALGWLEFHEVETYRDPFKDRSFPQTAALAL… |
| A0A829I356 | 19-157 | None |
| V9G3X6 | 1-159 | None |
| A0A7V3AEY9 | 325-483 | None |
| W8YNA3 | 291-456 | None |
| T2I957 | 198-354 | None |
| A0A4Q2WLP3 | 100-248 | None |
| A0A3T1DX54 | 115-272 | None |
| C2VXT5 | 133-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.