DPCstruct | MC51999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04839 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G3VP71 | 5-79 | LIAFSLDQRVGNRFVPLTDFYFWPQTDAWEGMKEFLEGEEFINQDEAIFILNQITEVINLWQDKDLNHARNFNLI |
| A0A7G5VUF1 | 2-82 | QLKLKVVSSKQLLAMAVDQLLTPTDKMPVTGYYFWPRTDAWNLLKTELESKIWIWPSERKKILDEATYVINHWQNHAFLLA |
| A0A3P6CUR3 | 45-132 | None |
| A0A7J9GZF0 | 1-69 | None |
| A0A830HFV9 | 89-173 | None |
| A0A358BWJ9 | 30-109 | None |
| A0A1J3D1P5 | 13-99 | None |
| A0A7S2Z8A9 | 11-85 | None |
| A0A5B8MU30 | 66-145 | None |
| A0A6A6LGA4 | 5-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.