DPCstruct | MC51995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1217 |
|---|---|
| Mean domain length (aa) | 216 ± 44 aa |
| Standard deviation of domain lengths | 43.74 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.69 |
| Pfam Score | 88.09 |
| Assigned Pfam label(s) | CL0214- CL0059- PF12258- CL0228- PF16076 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9Z8F1 | 11-211 | MGLIETGMAWFWSDARVKKWFDVEGYENLTRALEAKKGVMVVGIHFMSLELGGRVMGLCRPMMATYRQHNSPLMEYVQTKGRLRSNK… |
| A0A399XTC8 | 11-216 | YWAVVALLWPWARFWHRWHFHGLDQVPRSGGVVIASNHISYLDPIALGYLGLRLRRPVRFLAKSELFEKKVAGVKLLGFLLGALGQI… |
| A0A399ZCG4 | 6-156 | None |
| A0A847F7U3 | 28-240 | None |
| A0A258VVY5 | 939-1168 | None |
| A0A1D2NIA0 | 289-521 | None |
| A0A158R443 | 360-593 | None |
| A0A1W9LG88 | 130-268 | None |
| A0A814S841 | 281-550 | None |
| A0A257SIR3 | 11-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.