DPCstruct | MC51994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.06 |
| Pfam Score | 95.65 |
| Assigned Pfam label(s) | CL0020- PF15443- PF01294 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226NYU1 | 181-321 | SSAIQAAALRRLLEFIDVYWTEAADYLADIEALYEDTGFSERELAGFIASKIYFYLEEYGEAMRFALQCGRWFRIDEPSLYVQRILA… |
| A0A3Q0JP01 | 1-85 | MIELKEFSLKKLNDIVDDFWPEVSEAIQKIEILHEDKGFPQYKLAALVASKVYFHLGSFSDSLQYALGAGDLFDVRNDTVYVKTI |
| A0A446J957 | 5-147 | None |
| A0A2G5UQL4 | 16-161 | None |
| J9BFR2 | 76-223 | None |
| B9RWJ0 | 1-141 | None |
| U7Q0J1 | 7-123 | None |
| A0A540LZW4 | 2-138 | None |
| R4XB38 | 1-153 | None |
| X6MLE9 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.