DPCstruct | MC5199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 151 ± 27 aa |
| Standard deviation of domain lengths | 27.25 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1ZMX2 | 35-197 | KTACDYIHPEELPKECFCKEPGPFSLLVQCNKKFTNKYFNDTIGMKIDVEPCNPLGSSISLDVVEKDHDIDYTITGIRAGESKNIPI… |
| A0A7S1AWH8 | 22-168 | CQVVQDGLPPRCNCSSEALTATLTCRVVMLGTDEVDIKADLFPCASVAHVDVVIMEQNHSQNLSIVDVRANEKKRVAVPGLSVKVPH… |
| K1PTA0 | 12-207 | None |
| A0A5A8DH25 | 30-169 | None |
| A0A5A8DGN0 | 17-180 | None |
| A0A7S0PB49 | 8-159 | None |
| A0A5A8CMU3 | 949-1119 | None |
| A0A8B6F2H3 | 318-441 | None |
| A0A3M6V4T6 | 64-184 | None |
| A0A6P8H768 | 36-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.