DPCstruct | MC51988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821BDD5 | 1-86 | MKLFIQLAIICYLSLYLVQAGNQQRSVLLEDVKTLTLHKGQRTEARRVSSIPQLKCIGGSAKCAYEPDVVQCYNRGSNGIDIQVRL |
| A0A2W1E0A0 | 7-87 | LYPALLAASGADALRSDKVKLSNIQSLTLRKGLQTSARRVDPIPQLKCVGGSARGLYEPEVMRCKNSGSDYDENSIQWTCT |
| A0A0V0Y697 | 6-93 | None |
| A9V768 | 1-90 | None |
| T1JX67 | 104-202 | None |
| A0A7J8DZV5 | 13-96 | None |
| A0A2G9SFS2 | 17-119 | None |
| A0A673GU77 | 1-88 | None |
| A0A0B1SZ51 | 4-89 | None |
| A0A2P4S9M6 | 4-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.