DPCstruct | MC51987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 420 ± 81 aa |
| Standard deviation of domain lengths | 80.62 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.38 |
| Pfam Score | 67.49 |
| Assigned Pfam label(s) | CL0020- CL0004- PF16192- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1W0R0 | 100-486 | RNSPLEIAYGSRATIKNMGYGGGLLHSHVQTYPEGSTQQQVTCYHHKDANNDWFFYPNRHDEDYDPEAEPRFIADGSTIRLIHAQTG… |
| A0A821B8V7 | 18-528 | HEATNEGDIVRLFHAEQEKFLTCDNYRKKSVVFLRATGRASATSATSSNALWEIEVVQQDPCRGGIGHWSSLFRFKHLATGQYLAAE… |
| A0A5J4P0A9 | 203-646 | None |
| A0A1X7SWY4 | 52-400 | None |
| A0A183SPW0 | 97-612 | None |
| T1FAS8 | 15-398 | None |
| A0A6V7X246 | 171-600 | None |
| A0A5K1K408 | 3-421 | None |
| A0A034VAR5 | 28-600 | None |
| B7XKD6 | 18-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.