DPCstruct | MC51986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 3.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 74.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A449B3S6 | 4-72 | TKFIIQTGGVISGLGKGVTLASIGNLLKAQGFSVFVLKLDPYLNIDPGVMSPVEHGEVYVTSDGGETDL |
| A0A821B454 | 1-74 | MFRHNSSSSMKYILVTGGVISGIGKGIISSSIGTILRSHGFRVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGG |
| A0A3Q0JM29 | 1-64 | None |
| A0A453A270 | 1-65 | None |
| A0A2G8S1L9 | 2-66 | None |
| A8J825 | 5-68 | None |
| A0A2K3LBS8 | 1-69 | None |
| A0A453JZ78 | 90-153 | None |
| A0A0D3ERZ1 | 1-69 | None |
| M7AKL0 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.