DPCstruct | MC51985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821ATB0 | 1-148 | INIDPDYSNRLLIPHVEKYSIFLILKENILWIILASLLYFLWFIFIAGISIVHILIYLILLIFFIISERTRRFALAALIYLTYLLLY… |
| A0A813WZD4 | 198-338 | FVKEHAIWIPVLSIFYFTWFIFVVGIMVLHIIVYFVTIILYFFNDKTRRFVLALFIYLIYVLVYDSMRVVPNYLISNIHTEDVYNIE… |
| A0A6C9IM02 | 1-146 | None |
| A0A819P5T4 | 167-306 | None |
| J9GGF5 | 8-152 | None |
| A0A820U572 | 352-499 | None |
| A0A814LSX2 | 101-245 | None |
| A0A818UW03 | 509-656 | None |
| A0A4Q5QSV9 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.