DPCstruct | MC51984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 367 |
|---|---|
| Mean domain length (aa) | 177 ± 35 aa |
| Standard deviation of domain lengths | 35.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.77 |
| Pfam Score | 43.96 |
| Assigned Pfam label(s) | CL0023- CL0021- PF14214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7T9I3 | 4-137 | VTVQYVNVYLPHKRSRKIKNYSYLSKMDRSSKDIFNPSIIEDFYPTRPNNMEDVSLYEFVANYKFDKIGENGEREYKLRSKPVLPNH… |
| A0A821AS99 | 17-193 | IKAHLDARYVSAPEAAWRLFEYPLHDKSHAIIRLAVHLPNQQPVYFAEGNEQQALEKAASKDTTLIAWFKLNSKDPDARQYLYHDIP… |
| A0A834T6D7 | 41-248 | None |
| A0A834T4M4 | 352-543 | None |
| A0A1R3KN73 | 2-128 | None |
| A0A445CC36 | 1-211 | None |
| A0A1U7XXA1 | 2-165 | None |
| A0A820USH9 | 467-688 | None |
| A0A817M6T9 | 572-784 | None |
| A0A1R3KVY0 | 608-826 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.