DPCstruct | MC51983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 197 ± 24 aa |
| Standard deviation of domain lengths | 24.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060WYM3 | 4-191 | QELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTDPAKPGVDHPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCL… |
| A0A821AG66 | 3-180 | ELRSPPRASSVVKDCIRHTYDFLVVNCDEMKEAQGTTTNRIEPSLKCSQFWNHFMYLLTRIINEDRERYNLVLNHQSSSVYIVIFLR… |
| A0A3B3BTE9 | 472-650 | None |
| A0A6H5HE19 | 188-382 | None |
| F1QVH9 | 833-1012 | None |
| A0A044S3H3 | 1079-1284 | None |
| A0A816DUC9 | 644-819 | None |
| A0A3Q1FQ11 | 841-1024 | None |
| A0A821YH57 | 60-303 | None |
| A0A821XPP9 | 558-802 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.