DPCstruct | MC51971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538RD08 | 1-113 | MQNRWSTEAAEKLSGLDLLVYTTRLIGADPTLVLWGGGNSSLKAVCADHTGRETRVLWIKGSGSDMRTATPQNFTALRLDELLPLLG… |
| A0A357CF33 | 1-123 | MKSQWNDSAANEVVAAYGAKGVGADIALRVYTTRLLGRDPLLVLHGGGNTSVKTRARDDLGQEHEVIAVKGSGADMADIEPWGLPSV… |
| A0A090Q8G1 | 11-128 | None |
| A0A4D4ML40 | 4-107 | None |
| A0A2V7SHT5 | 18-140 | None |
| A0A2R5GFJ5 | 382-500 | None |
| A0A1H4WSM9 | 452-555 | None |
| A0A2I2A5G0 | 1-108 | None |
| A0A0Y0N533 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.