DPCstruct | MC51970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 24.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.35 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | CL0042- PF03352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2JZ25 | 5-148 | LCLEGFQSGLSWRTILAKRENFRAAFHHFDFHRVAQFTEEDVTRLLQDAGIVRHRGKIEAVINNAQRAIDMVEQEGSLARFFWRFEP… |
| A0A0C1BXL8 | 1-136 | MSWITILKRREGYRKAFANFDPKKVAAFGEDKIAALMLDEGIIRNKLKIQSAVTNAKLFLDIQKEFGSFDAYVWQFVGGSPLQNRRT… |
| A0A7R9WYM9 | 227-409 | None |
| A0A7R9ZPV2 | 3-125 | None |
| A0A4Y1QT20 | 2-117 | None |
| A0A835R5C7 | 45-222 | None |
| A0A0B2P9C5 | 1-119 | None |
| F8AGI4 | 12-141 | None |
| A0A3M0Y463 | 11-141 | None |
| A0A0S7XTV8 | 23-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.