DPCstruct | MC5197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 111 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2D402 | 201-285 | PLVLEFKKPDSSTTTASFTERPIGLEFSNLAPIKVGKIYADSPAARAKVQLGWYLTKIGEADVHESHNFREVMKLFKEGVNALDD |
| A0A7S1ALP6 | 12-121 | STEVYDITPVPKPLAVPTGVSTSPSAAVELVYEASDGETKSVRSVERPLGATYSDTVPLTILEVHPRSRAFSLGLQKGWILRAIDGV… |
| A0A813B2A6 | 17-144 | None |
| A0A812T4M4 | 605-695 | None |
| A0A812SBM7 | 10-116 | None |
| A0A7S2MM53 | 109-239 | None |
| A0A812RZ53 | 4-92 | None |
| A0A1Q9ENI3 | 105-231 | None |
| A0A7S1F2C7 | 58-203 | None |
| A0A7S1FAK4 | 476-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.