DPCstruct | MC51964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388PLP1 | 1-73 | MTTPAPKLGWFVHALLGASILGGLGFLGGFFGPMIFKPEANQGPLLGIFITGPLGAVFGGIGGALVGWWRNRR |
| A0A4V3E410 | 2-61 | GIIGSALKGGCTLGAIGFVAGFVGPIILAPDANQGPLLGIFITGPAGFVLGLIGGAIAAL |
| A0A1B3LMJ6 | 15-83 | None |
| A0A2V5RGC4 | 1-75 | None |
| A0A5E8XQ70 | 92-162 | None |
| F9ZF72 | 47-113 | None |
| A0A0K2G957 | 26-95 | None |
| A0A529X0T9 | 54-124 | None |
| A0A7D7ZNY0 | 68-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.