DPCstruct | MC51962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Standard deviation of domain lengths | 10.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 92.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817HFY5 | 47-128 | GTYKKLIEFVKAKELSFKYVITFNMDEYVGLARDHPESYHSYMWNNFFKHIDIDPNNVHILDGNATDLIHECNEFERAIQEA |
| A0A388P6E6 | 2-67 | SFRSVITFNLDEYEGLGPTHPQSYRFFMEENLFRHLDIPAANIHIPDGLANDPAKNCADFETAIHD |
| A0A2G9V381 | 79-159 | None |
| A0A364N3C6 | 2-70 | None |
| A0A218Z9Z3 | 5-58 | None |
| A0A5C2SUP1 | 1-59 | None |
| D4XX52 | 237-311 | None |
| A0A1A9X9T3 | 164-235 | None |
| A0A7R9A201 | 47-128 | None |
| B5CML2 | 10-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.