DPCstruct | MC51954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162FMD5 | 1-102 | MKKFIENIISLDINDIKSFDFYFDELFGLEIIKYEIKYEFLIKLSRNNDNLICFGSGAVERKGSKALAPPIFNRWSWHEYFNDSILF… |
| A0A1V3KAA7 | 6-93 | PVYTFTYSQFKSSKLPSINIPFIISIILNDQKYEFLIKLNNSNKILVMGSGAYDPDIISPPVFQRHAWINEFKENIIYYNDPTLYLGN |
| A0A1H5H8L7 | 525-646 | None |
| A0A368YAW5 | 6-97 | None |
| A0A1G8WH47 | 1-99 | None |
| A0A7L8E259 | 591-668 | None |
| A0A846TKP0 | 685-770 | None |
| U6EE05 | 6-100 | None |
| A0A1N7REE3 | 176-271 | None |
| A0A0Q4MKK9 | 43-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.