DPCstruct | MC51952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 4.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0C7B9 | 251-306 | DGLTTNGVLIMHPRGQFCGGEAECGLWREVSVGGGVFSLRESRSAQQKGCVVEDEN |
| Q5ZM03 | 1-56 | MDGLTTNGVLVMHPRNGFTEDSKPGVWREISVCGNVFSLRETRSAQQRGKMVRVET |
| A0A7R9P9Z9 | 202-257 | None |
| A0A3Q0JDQ1 | 51-105 | None |
| A0A834XKW6 | 289-345 | None |
| N6TPI9 | 85-140 | None |
| A0A669CNP2 | 306-359 | None |
| A0A673H6T5 | 122-176 | None |
| A0A7R8VBF1 | 301-356 | None |
| A0A7R9DNA8 | 78-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.