DPCstruct | MC51946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 19.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355E3L0 | 1-127 | MGIFDKGSAGAEAGQQGQRPAPDVVEKIVKEYGAFLESYAPKAGRISDVAELPHPKERIKEALLAAFAYADAPMKELLRAGYVCLYH… |
| A0A0Q6ZGU7 | 225-350 | EARIIPQSEVDRLRENIPQILDTYTNLIIKHSGEIIDSSWLPVSKEQMIEIFKSMWVNAETEDHRDAVESLWSSLSFFQEGVGSTPI… |
| A0A2D6HJ15 | 533-638 | None |
| A0A442YZE4 | 2-143 | None |
| A0A6H0ZQX6 | 2-172 | None |
| A0A2D8HM86 | 84-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.