DPCstruct | MC51940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7UDA9 | 2-69 | KKILEIANGVEAVQDGRIHIEKINGPFLFTHGALPAQYSAGLKLAIERGFLMMHESGTYVKFTQAGSD |
| A0A160UW26 | 4-82 | TAERPYADPEAAARKLLELAANVEAVQDGRIYIERINSPFLYTLKASGSEFGAGIKYSVECGWLGLHESGTYVKLMPPG |
| A0A090MHA2 | 5-84 | None |
| A0A2U3Q6H6 | 1-71 | None |
| A0A4Y3ZUH7 | 1-58 | None |
| A0A1N6KBS3 | 1-71 | None |
| A0A1M7UUQ5 | 4-85 | None |
| A0A1X3EUG0 | 2-60 | None |
| A0A7Y6W1V6 | 168-244 | None |
| A0A537QFW2 | 4-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.