DPCstruct | MC5194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 164 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1AJC4 | 43-193 | VEDPLAAVHVLSDPMDPEVAAWLLEQGVRRVVVGHKPSGDSPAVLSSCYTGVEVISADTSFSDMDAADNRGVAVPGVLLQGPLEANS… |
| A0A7S1BH08 | 417-570 | DPLAFESVCSDPRCPEAAAWLRRNGIRRVVVGHRPTGDCPAVLAAGATGVEIVSGGTSYADPGRGDGRGRAVAVLEVVGRSAEDSRL… |
| A0A7R9UA24 | 341-508 | None |
| A0A024GB90 | 274-453 | None |
| A0A7S3F7J2 | 1-177 | None |
| A0A812Z238 | 594-741 | None |
| A0A812VQT5 | 227-374 | None |
| A0A812Q458 | 252-431 | None |
| A0A812IXH3 | 100-248 | None |
| A0A812MHB9 | 327-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.