DPCstruct | MC51933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 18.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DPK6 | 12-144 | HNDGTRIDEQVDKLSGSSDLVHQLISCGQLNVAVVVSSLVSGRQARFLEVSWDNASPLPGDWVGLFNHDPSSGSPIGPLFAAGVSTS… |
| A0A2J7Q8Y6 | 7-119 | AHCVAEFADTDKELQVSIIVSPVPKDNVARRLILSWENASPLSGDWIGLFNEEPTDLSIPLFVVQPHNPSGWAETTSHETASYSQDL… |
| A0A146LAC2 | 1-162 | None |
| A0A6H5H190 | 272-418 | None |
| A0A7R9AQA9 | 1-110 | None |
| A0A834KF44 | 22-121 | None |
| A0A0K8VVK3 | 1-132 | None |
| A0A5E4MCF0 | 73-182 | None |
| A0A7R9JZ50 | 21-146 | None |
| A0A1Y1M6A2 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.