DPCstruct | MC51932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 279 ± 34 aa |
| Standard deviation of domain lengths | 33.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DP56 | 9-346 | QSKQSTNKGKKNEEDLDTSKFASETLESERESLLAYREATAHAPAPQIVIDPPSRVVDIDTRKSNTQDSLSTGPAVNGGSGHTSNLL… |
| A0A7R9BAG6 | 1-238 | QSCKISPNEDISPASPKMNLPVVAPEVMRTASERHQKGLMSPYIYQILTQGEMKLPVLLEDENHKEFPSIHLLYRPVRQMVYAIVFN… |
| A0A7J8J5D1 | 13-239 | None |
| A0A6A4VK16 | 113-392 | None |
| A0A2R7W9U3 | 100-407 | None |
| A0A2K6P458 | 66-335 | None |
| A0A7N9AZ27 | 379-708 | None |
| A0A2G8JHB5 | 161-428 | None |
| A0A6I9KRK4 | 315-572 | None |
| A0A384BVN1 | 3-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.