DPCstruct | MC51930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 122 ± 27 aa |
| Standard deviation of domain lengths | 26.88 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.36 |
| Pfam Score | 74.96 |
| Assigned Pfam label(s) | PF20154- PF00571- CL0183- PF03471- CL0582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DMA3 | 546-671 | HLAFVIDEYGALQGIVTLEDILEEIVGEISDEHDLITENFIKKISDNMYHIEGKSTIRDINRQLHWNLPDEEATTLAGMIVNEIERI… |
| A0A3B8ZMY8 | 1-78 | DGSWLVDGQFSFYEFLEYFDMEDLYNEHDYNTLSGLILEILERVPRTGEKLRWLNFKFEIVDMDGARIDKVLVTKEKE |
| A0A1I3ZEM5 | 72-229 | None |
| A0A812NL08 | 531-660 | None |
| A0A812NK11 | 153-284 | None |
| A0A6J7HPJ9 | 30-152 | None |
| A0A7R8WZM6 | 314-416 | None |
| A0A7W0NNW1 | 13-117 | None |
| A0A524PSS4 | 157-273 | None |
| A0A0S8CIZ0 | 16-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.