DPCstruct | MC51928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 150 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JHQ7 | 1-146 | MNLSQLRLHYMRSLVYNLLECNGYTVIHPQERQVSGSVIQIHLALSSSNSALPNRHEVVCAPVVNSKHDTKEDSLFARHYLKQRTAD… |
| A0A182SR16 | 68-216 | EKVYVEEPTGNDYDTISMTEFRANILRSTIKKCYQHGGYTIVEKTDLRDNEIPPDVRHIKVVHQRSKPSPVVPHVEVLCGVVLTGLE… |
| A0A0L0CBD6 | 143-297 | None |
| A0A1W4XFP5 | 125-265 | None |
| A0A7R8VEX0 | 112-273 | None |
| A0A7R9K0B2 | 12-174 | None |
| A0A2R7WMC2 | 59-202 | None |
| A0A7R9IJA5 | 12-178 | None |
| E0VNF0 | 2-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.