DPCstruct | MC51915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 233 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4S0R3 | 138-414 | AVITAIATFLMTYTYRISGDELMAGFSTFSDLAPHTAMVSSFSNGFNFPTQYMHFSGDGIQYHFMFYFFCGMMNYGGLPIDMAINLP… |
| A0A536L9Z4 | 2-216 | LVVALGIGYLFARAVEITPDAWLAHYAATWADWSFHASVATSFAHGHNLPPQNPNFAGTPFRYPFAPDFASALLLAGGWTVPASLAW… |
| A0A0G0M9J3 | 9-231 | None |
| W4V976 | 4-214 | None |
| A0A5E4P4K4 | 123-390 | None |
| A0A0G1U489 | 8-235 | None |
| A0A536LM83 | 305-534 | None |
| A0A7V9ZEB5 | 90-340 | None |
| H8I640 | 100-371 | None |
| A0A2V7Y4R9 | 27-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.