DPCstruct | MC51913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 8 aa |
| Standard deviation of domain lengths | 8.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18989 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7ECD4 | 33-156 | KNIEVLSQYLSQEEYLFNGRLRHIILSEQVFHSDENEESEKLQAAAYCLAYRKIAKTPGIDAFILHAHVDNRDEFGLNLGLWRRDKN… |
| A0A4V0WV17 | 1-118 | MFREKRRSIILSEQGFHSNGTEQGDREQAAGFCYAWEKISRLAGIDAFILHRHAYHQYEGGLNLGLWRRKADSVVTPDTERPIYDYF… |
| A0A328UCB4 | 379-516 | None |
| A0A353DVE6 | 1-139 | None |
| A0A3N7JGF5 | 347-476 | None |
| R7EA06 | 842-970 | None |
| A0A4U8Q6T9 | 412-541 | None |
| A0A1Y5KIJ8 | 767-899 | None |
| A0A6N6PJI4 | 306-427 | None |
| A0A7C6TQU1 | 427-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.