DPCstruct | MC51912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 120 ± 22 aa |
| Standard deviation of domain lengths | 21.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1V1Y5 | 2-126 | ARADAAEPDMGLRTWKGDRIAAADVTVAKNFLAPSEVRELNRLTDLLLTIFEDQLETGRLTTMGEATRLLDAQLQGLGRVVLSNGGR… |
| A0A4P5ZCQ4 | 21-162 | SGPAHGQTAAEVIHARVDAEKPLMRLRTTRPGGIIRKEDVTVAKNYFDAEELGTLNRVVNAYIEFAELRVLQRRVMTMRDWVTKLDE… |
| A0A0F5J9A2 | 150-279 | None |
| A0A166FFZ0 | 187-313 | None |
| A0A811FZ21 | 4-164 | None |
| A0A7U9RB37 | 59-164 | None |
| A0A2H0UPR7 | 149-293 | None |
| A0A1G5X267 | 11-97 | None |
| A0A7W9V4U7 | 16-148 | None |
| A0A2P7NTW1 | 29-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.