DPCstruct | MC5191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255G9W9 | 1-100 | MRISMTFDCADARAQARFWATALDYEEAPPPEGWTNWDDWLRDNDVPETEWNDGAWLRDPEGVRPAISFLKVPEPKTAKNRIHIDLQ… |
| A0A1C4KHU1 | 9-110 | PPVHWKLVVDAADPHAQALFWSAALGYTIEDNDALIARVLSFGGAPEEATVEFQGRRAWRDLIAVRHPDDPFDKDTGIGEGRRILFQ… |
| A0A1G9T8F3 | 1-80 | None |
| A0A4Q8CP74 | 3-88 | None |
| A0A4R7IK15 | 1-116 | None |
| A0A7W0NE67 | 1-88 | None |
| A0A178X3S5 | 9-99 | None |
| A0A1C4PHJ6 | 301-399 | None |
| A0A7J0C9K0 | 3-97 | None |
| A0A127A357 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.