DPCstruct | MC51905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 95.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3IG29 | 187-273 | FKELGLKWYAVPVVSNMLFDCGGLEFPAAPFNGWYMGTEIGARNLCDVQRYNILEIVGQHMGLDCRSSVNLWKDLALVEVNIAVLHS |
| A0A2U3YZI5 | 339-425 | FRELQLKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINVAVLHS |
| A0A2G5X2V8 | 108-184 | None |
| A0A7R9IWQ5 | 264-350 | None |
| A0A640VP22 | 56-133 | None |
| A0A243V8I9 | 1-77 | None |
| A0A4P2PVW9 | 991-1079 | None |
| T0LHN1 | 1-70 | None |
| A0A428YLW8 | 186-272 | None |
| A0A1T3NPD6 | 233-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.