DPCstruct | MC5190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6W771 | 39-118 | YIIMGPFDSKVDRKAIGKNNNAEIIGVKNLDEAKEVCKSLIGLADVIELCGAFEESGAREIIDATNCKIPIGFVTHLDFQ |
| A0A255G1F4 | 1-96 | MLEHPGADPVRDRHELTAPGIRALIVPVPSGALAAEVARDLADEGVRLIELCGGITTADVAAVQEAVGDRVAVGHVLFSVEALAGAA… |
| A0A0D4ZYR9 | 1-83 | None |
| A0A5B8T0Z8 | 6-86 | None |
| A0A7C5DXE8 | 1-110 | None |
| E6MH83 | 2-85 | None |
| A0A4R4YPG6 | 26-106 | None |
| A0A7S7EUL7 | 2-92 | None |
| A0A1Q8LEE4 | 11-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.